File:Beta endorphin AA label.svg

Page contents not supported in other languages.
This is a file from the Wikimedia Commons
Source: Wikipedia, the free encyclopedia.

Original file(SVG file, nominally 2,403 × 951 pixels, file size: 216 KB)

Summary

Description
English: beta-Endorphin (β-endorphin) is an endogenous opioid neuropeptide and peptide hormone that is produced in certain neurons within the central nervous system and peripheral nervous system. It is one of three endorphins that are produced in humans, the others of which include α-endorphin and γ-endorphin.

SEQUENCE:

monogramatic

YGGFMTSEKSQTPLVTLFKNAIIKNAYKKGE

trigramatic

Tyr-Gly-Gly-Phe-Met-Thr-Ser-Glu-Lys-Ser-Gln-Thr-Pro-Leu-Val-Thr-Leu-Phe-Lys-Asn-Ala-Ile-Ile-Lys-Asn-Ala-Tyr-Lys-Lys-Gly-Glu
Date
Source Own work
Author Mplanine

Licensing

I, the copyright holder of this work, hereby publish it under the following license:
w:en:Creative Commons
attribution share alike
This file is licensed under the Creative Commons Attribution-Share Alike 4.0 International license.
You are free:
  • to share – to copy, distribute and transmit the work
  • to remix – to adapt the work
Under the following conditions:
  • attribution – You must give appropriate credit, provide a link to the license, and indicate if changes were made. You may do so in any reasonable manner, but not in any way that suggests the licensor endorses you or your use.
  • share alike – If you remix, transform, or build upon the material, you must distribute your contributions under the same or compatible license as the original.

Captions

beta-Endorphin (β-endorphin) is an endogenous opioid neuropeptide and peptide hormone that is produced in certain neurons within the central nervous system and peripheral nervous system.

Items portrayed in this file

depicts

26 January 2023

image/svg+xml

bc7c19a34cb4588f381c79b0bff287c4bec02c91

221,095 byte

951 pixel

2,403 pixel

File history

Click on a date/time to view the file as it appeared at that time.

Date/TimeThumbnailDimensionsUserComment
current22:23, 26 January 2023Thumbnail for version as of 22:23, 26 January 20232,403 × 951 (216 KB)MplanineUploaded own work with UploadWizard
The following pages on the English Wikipedia use this file (pages on other projects are not listed):

Global file usage

The following other wikis use this file:

Metadata